Structure of PDB 1hc9 Chain B

Receptor sequence
>1hc9B (length=74) Species: 8616 (Bungarus multicinctus) [Search protein sequence]
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPS
KKPYEEVTCCSTDKCNPHPKQRPG
3D structure
PDB1hc9 The Binding Site of Acetylcholine Receptor as Visualized in the X-Ray Structure of a Complex between Alpha-Bungarotoxin and a Mimotope Peptide.
ChainB
Resolution1.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B T6 A7 T8 S9 I11 D30 R36 K38 V39 V40 H68 K70 T6 A7 T8 S9 I11 D30 R36 K38 V39 V40 H68 K70
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hc9, PDBe:1hc9, PDBj:1hc9
PDBsum1hc9
PubMed11683996
UniProtP60615|3L21A_BUNMU Alpha-bungarotoxin

[Back to BioLiP]