Structure of PDB 1h2b Chain B

Receptor sequence

>1h2bB (length=344) Species: 56636 (Aeropyrum pernix)

LKAARLHEYNKPLRIEDVDYPRLEGRFDVIVRIAGAGVCHTDLHLVQGMW
HELLQPKLPYTLGHENVGYIEEVAEGVEGLEKGDPVILHPAVTDGTCLAC
RAGEDMHCENLEFPGLNIDGGFAEFMRTSHRSVIKLPKDISREKLVEMAP
LADAGITAYRAVKKAARTLYPGAYVAIVGVGGLGHIAVQLLKVMTPATVI
ALDVKEEKLKLAERLGADHVVDARRDPVKQVMELTRGRGVNVAMDFVGSQ
ATVDYTPYLLGRMGRLIIVGYGGELRFPTIRVISSEVSFEGSLVGNYVEL
HELVTLALQGKVRVEVDIHKLDEINDVLERLEKGEVLGRAVLIP

3D structure

• PDB: 1h2b The structure of an alcohol dehydrogenase from the hyperthermophilic archaeon Aeropyrum pernix.
• Chain: B
• Resolution: 1.62 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C54 H55 T56 H59 H79 E80 D109 C112 C115 C123 E127 D168 T172 R354
• Catalytic site (residue number reindexed from 1): C39 H40 T41 H44 H64 E65 D94 C97 C100 C108 E112 D153 T157 R339
• Enzyme Commision number: 1.1.1.1: alcohol dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	OCA	B	T56 W65 H79 D168 V309	T41 W50 H64 D153 V294
BS02	NAJ	B	C54 H55 T56 H59 T172 V195 G196 G197 L198 D218 V219 K223 F261 V262 T267 Y270 V284 G285 Y286 L308 V309 R354	C39 H40 T41 H44 T157 V180 G181 G182 L183 D203 V204 K208 F246 V247 T252 Y255 V269 G270 Y271 L293 V294 R339
BS03	ZN	B	C54 H79 D168	C39 H64 D153
BS04	ZN	B	D109 C112 C115 C123	D94 C97 C100 C108

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004022 alcohol dehydrogenase (NAD+) activity
• GO:0008270 zinc ion binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

External links

• PDB: RCSB:1h2b, PDBe:1h2b, PDBj:1h2b
• PDBsum: 1h2b
• PubMed: 12927540
• UniProt: Q9Y9P9