Structure of PDB 1gzz Chain B

Receptor sequence

>1gzzB (length=60) Species: 9606 (Homo sapiens)

GPETLCGAELVDALQFVCGDRGFYFNKPTGYAPQTGIVDECCFRSCDLRR
LEMYCAPLKP

3D structure

• PDB: 1gzz Structural Origins of the Functional Divergence of Human Insulin-Like Growth Factor-I and Insulin
• Chain: B
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	C15	B	F25 N26	F25 N26

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0008083 growth factor activity

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:1gzz, PDBe:1gzz, PDBj:1gzz
• PDBsum: 1gzz
• PubMed: 12135360
• UniProt: P05019|IGF1_HUMAN Insulin-like growth factor I (Gene Name=IGF1)