Structure of PDB 1gzr Chain B |
>1gzrB (length=61) Species: 9606 (Homo sapiens) [Search protein sequence] |
ETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSPQTGIVDECCFRSCDLR RLEMYCAPLKP |
|
PDB | 1gzr Structural Origins of the Functional Divergence of Human Insulin-Like Growth Factor-I and Insulin |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
C15 |
B |
F25 N26 |
F23 N24 |
|
|
|
|