Structure of PDB 1gcv Chain B

Receptor sequence

>1gcvB (length=136) Species: 89020 (Mustelus griseus)

VHWTQEERDEISKTFQGTDMKTVVTQALDRMFKVYPWTNRYFQKRTDFRS
SIHAGIVVGALQDAVKHMDDVKTLFKDLSKKHADDLHVDPGSFHLLTDCI
IVELAYLRKDCFTPHIQGIWDKFFEVVIDAISKQYH

3D structure

• PDB: 1gcv The functional similarity and structural diversity of human and cartilaginous fish hemoglobins.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	Y41 F42 R45 H53 I56 L78 K81 H82 L86 V88 L96	Y41 F42 R45 H53 I56 L78 K81 H82 L86 V88 L96

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:1gcv, PDBe:1gcv, PDBj:1gcv
• PDBsum: 1gcv
• PubMed: 11243818
• UniProt: Q9YGW1|HBB_MUSGR Hemoglobin subunit beta (Gene Name=HBB)