Structure of PDB 1gar Chain B

Receptor sequence
>1garB (length=193) Species: 562 (Escherichia coli) [Search protein sequence]
MNIVVLISGNGSNLQAIIDACKTNKIKGTVRAVFSNKADAFGLERARQAG
IATHTLIASAFDSREAYDRELIHEIDMYAPDVVVLAGFMRILSPAFVSHY
AGRLLNIHPSLLDEEHGTSVHFVTDELDGGPVILQAKVPVFAGDSEDDIT
ARVQTQEHAIYPLVISWFADGRLKMHENAAWLDGQRLPPQGYA
3D structure
PDB1gar Towards structure-based drug design: crystal structure of a multisubstrate adduct complex of glycinamide ribonucleotide transformylase at 1.96 A resolution.
ChainB
Resolution1.96 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) N106 H108 S135 D144
Catalytic site (residue number reindexed from 1) N106 H108 S119 D128
Enzyme Commision number 2.1.2.2: phosphoribosylglycinamide formyltransferase 1.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 U89 B N10 G11 S12 N13 R64 G87 M89 R90 I91 L92 N106 H108 P109 V139 N10 G11 S12 N13 R64 G87 M89 R90 I91 L92 N106 H108 P109 V123 MOAD: Ki=100pM
Gene Ontology
Molecular Function
GO:0003824 catalytic activity
GO:0004644 phosphoribosylglycinamide formyltransferase activity
GO:0016740 transferase activity
Biological Process
GO:0006164 purine nucleotide biosynthetic process
GO:0006189 'de novo' IMP biosynthetic process
GO:0006974 DNA damage response
GO:0009058 biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1gar, PDBe:1gar, PDBj:1gar
PDBsum1gar
PubMed7776369
UniProtP08179|PUR3_ECOLI Phosphoribosylglycinamide formyltransferase (Gene Name=purN)

[Back to BioLiP]