Structure of PDB 1g9y Chain B

Receptor sequence

>1g9yB (length=152) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

NTKYNKEFLLYLAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQR
RWFLDKLVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLKLKQKQ
ANLVLKIIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAV
LD

3D structure

PDB

1g9y The homing endonuclease I-CreI uses three metals, one of which is shared between the two active sites.

Chain

Resolution

2.05 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	G219 D220
Catalytic site (residue number reindexed from 1)	G18 D19
Enzyme Commision number	3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	B	D220 G221 S222 I224 Q226 K228 Q244 T246 Q247 K248 R270 V273 A333 N336 D337 S338 R341 K342 T343	D19 G20 S21 I23 Q25 K27 Q43 T45 Q46 K47 R69 V72 A132 N135 D136 S137 R140 K141 T142
BS02	dna	B	S232 Y233 K234 Q238 R268 R270 E280 I281 K316 K339 T340	S31 Y32 K33 Q37 R67 R69 E79 I80 K115 K138 T139
BS03	CA	B	G219 D220	G18 D19

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding

	Biological Process
GO:0006314	intron homing

	Cellular Component
GO:0009507	chloroplast

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1g9y, PDBe:1g9y, PDBj:1g9y
PDBsum	1g9y
PubMed	11276249
UniProt	P05725\|DNE1_CHLRE DNA endonuclease I-CreI

[Back to BioLiP]