Structure of PDB 1g1x Chain B

Receptor sequence
>1g1xB (length=88) Species: 274 (Thermus thermophilus) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYREIVEKLGLRG
3D structure
PDB1g1x Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain.
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna B K7 T21 Q27 L30 H45 K47 D48 H50 K7 T21 Q27 L30 H45 K47 D48 H50
BS02 rna B P1 R16 F17 D20 T21 G22 S23 T24 R34 R37 H41 H50 S51 R53 R64 Y68 P1 R16 F17 D20 T21 G22 S23 T24 R34 R37 H41 H50 S51 R53 R64 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1g1x, PDBe:1g1x, PDBj:1g1x
PDBsum1g1x
PubMed10753109
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]