Structure of PDB 1fx7 Chain B

Receptor sequence

>1fx7B (length=220) Species: 1773 (Mycobacterium tuberculosis)

MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMER
DGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAE
ACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLDELGVLVRLTELPAG
SPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIP
GHENVTLPHEMAHAVKVEKV

3D structure

• PDB: 1fx7 Crystal structure of the iron-dependent regulator from Mycobacterium tuberculosis at 2.0-A resolution reveals the Src homology domain 3-like fold and metal binding function of the third domain.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CO	B	H79 E83 H98 E172 Q175	H79 E83 H98 E162 Q165
BS02	CO	B	M10 C102 E105 H106	M10 C102 E105 H106
BS03	CO	B	H219 H223	H209 H213

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0008198 ferrous iron binding
• GO:0008270 zinc ion binding
• GO:0016151 nickel cation binding
• GO:0030145 manganese ion binding
• GO:0046870 cadmium ion binding
• GO:0046914 transition metal ion binding
• GO:0046983 protein dimerization activity
• GO:0050897 cobalt ion binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006979 response to oxidative stress
• GO:0019540 catechol-containing siderophore biosynthetic process
• GO:0045892 negative regulation of DNA-templated transcription

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0009274 peptidoglycan-based cell wall

External links

• PDB: RCSB:1fx7, PDBe:1fx7, PDBj:1fx7
• PDBsum: 1fx7
• PubMed: 11053439
• UniProt: P9WMH1|IDER_MYCTU Iron-dependent repressor IdeR (Gene Name=ideR)