Structure of PDB 1fo0 Chain B |
>1fo0B (length=112) Species: 10090 (Mus musculus) [Search protein sequence] |
VTLLEQNPRWRLVPRGQAVNLRCILKNSQYPWMSWYQQDLQKQLQWLFTL RSPGDKEVKSLPGADYLATRVTDTELRLQVANMSQGRTLYCTCSADRVGN TLYFGEGSRLIV |
|
PDB | 1fo0 Crystal structure of a T cell receptor bound to an allogeneic MHC molecule. |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
B |
D97 R98 V99 |
D96 R97 V98 |
|
|
|
|