Structure of PDB 1fjm Chain B

Receptor sequence
>1fjmB (length=289) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
LNLDSIIGRLLEVQGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAY
KIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPD
KDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAK
RQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPA
3D structure
PDB1fjm Three-dimensional structure of the catalytic subunit of protein serine/threonine phosphatase-1.
ChainB
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D64 H66 D92 D95 R96 N124 H125 H173 R221 H248
Catalytic site (residue number reindexed from 1) D54 H56 D82 D85 R86 N114 H115 H163 R211 H238
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B R96 S129 Y134 W206 R221 Y272 C273 G274 E275 R86 S119 Y124 W196 R211 Y262 C263 G264 E265
BS02 MN B D92 N124 H173 H248 D82 N114 H163 H238
BS03 MN B D64 H66 D92 D54 H56 D82
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0016791 phosphatase activity
GO:0017018 myosin phosphatase activity
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0072542 protein phosphatase activator activity
GO:1901567 fatty acid derivative binding
Biological Process
GO:0005977 glycogen metabolic process
GO:0006446 regulation of translational initiation
GO:0006470 protein dephosphorylation
GO:0032922 circadian regulation of gene expression
GO:0042752 regulation of circadian rhythm
GO:0043153 entrainment of circadian clock by photoperiod
GO:0043558 regulation of translational initiation in response to stress
GO:0048511 rhythmic process
GO:0051301 cell division
GO:0090263 positive regulation of canonical Wnt signaling pathway
Cellular Component
GO:0000164 protein phosphatase type 1 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0072357 PTW/PP1 phosphatase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1fjm, PDBe:1fjm, PDBj:1fjm
PDBsum1fjm
PubMed7651533
UniProtP62139|PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (Gene Name=PPP1CA)

[Back to BioLiP]