Structure of PDB 1fip Chain B

Receptor sequence

>1fipB (length=73) Species: 562 (Escherichia coli) [Search protein sequence]

PLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQALLDMVMQYTRGNQT
RAALMMGINRGTLRKKLKKYGMN

3D structure

PDB

1fip The structure of Fis mutant Pro61Ala illustrates that the kink within the long alpha-helix is not due to the presence of the proline residue.

Chain

Resolution

1.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	A34 Y38	A9 Y13
BS02	peptide	B	P26 L27	P1 L2

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0001046	core promoter sequence-specific DNA binding
GO:0001216	DNA-binding transcription activator activity
GO:0001217	DNA-binding transcription repressor activity
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0005515	protein binding
GO:0042803	protein homodimerization activity
GO:0043565	sequence-specific DNA binding
GO:0044374	sequence-specific DNA binding, bending

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription
GO:0009314	response to radiation
GO:0032359	provirus excision
GO:0045892	negative regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription
GO:0045911	positive regulation of DNA recombination
GO:0051276	chromosome organization

External links

PDB	RCSB:1fip, PDBe:1fip, PDBj:1fip
PDBsum	1fip
PubMed	7961857
UniProt	P0A6R3\|FIS_ECOLI DNA-binding protein Fis (Gene Name=fis)