Structure of PDB 1fdq Chain B

Receptor sequence

>1fdqB (length=131) Species: 9606 (Homo sapiens)

VEAFCATWKLTNSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVV
IRTLSTFKNTEISFQLGEEFDETTADDRNCKSVVSLDGDKLVHIQKWDGK
ETNFVREIKDGKMVMTLTFGDVVAVRHYEKA

3D structure

• PDB: 1fdq Crystal structure and thermodynamic analysis of human brain fatty acid-binding protein.
• Chain: B
• Resolution: 2.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HXA	B	M520 T560 E572 T574 A575 D576 L617 R626 Y628	M20 T60 E72 T74 A75 D76 L117 R126 Y128	MOAD: Kd=53.4nM

Gene Ontology

Molecular Function

• GO:0005504 fatty acid binding
• GO:0005515 protein binding
• GO:0008289 lipid binding

Biological Process

• GO:0007399 nervous system development
• GO:0008285 negative regulation of cell population proliferation
• GO:0015908 fatty acid transport
• GO:0050673 epithelial cell proliferation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:1fdq, PDBe:1fdq, PDBj:1fdq
• PDBsum: 1fdq
• PubMed: 10854433
• UniProt: O15540|FABP7_HUMAN Fatty acid-binding protein, brain (Gene Name=FABP7)