Structure of PDB 1f95 Chain B

Receptor sequence
>1f95B (length=89) Species: 10116 (Rattus norvegicus) [Search protein sequence]
MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY
NPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
3D structure
PDB1f95 Structural basis of diverse sequence-dependent target recognition by the 8 kDa dynein light chain.
ChainB
ResolutionN/A
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide B N10 N61 F62 G63 S64 Y65 V66 T67 H68 E69 T70 Y75 A82 L84 N10 N61 F62 G63 S64 Y65 V66 T67 H68 E69 T70 Y75 A82 L84
Gene Ontology
Molecular Function
GO:0004857 enzyme inhibitor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0019904 protein domain specific binding
GO:0030235 nitric-oxide synthase regulator activity
GO:0036487 nitric-oxide synthase inhibitor activity
GO:0042802 identical protein binding
GO:0044877 protein-containing complex binding
GO:0045505 dynein intermediate chain binding
GO:0060703 deoxyribonuclease inhibitor activity
GO:0097110 scaffold protein binding
Biological Process
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0007017 microtubule-based process
GO:0007286 spermatid development
GO:0035721 intraciliary retrograde transport
GO:0035774 positive regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0042326 negative regulation of phosphorylation
GO:0044458 motile cilium assembly
GO:0045019 negative regulation of nitric oxide biosynthetic process
GO:0051881 regulation of mitochondrial membrane potential
GO:0110027 negative regulation of DNA strand resection involved in replication fork processing
GO:0160040 mitocytosis
GO:1902857 positive regulation of non-motile cilium assembly
Cellular Component
GO:0000776 kinetochore
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005929 cilium
GO:0008180 COP9 signalosome
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0030141 secretory granule
GO:0030286 dynein complex
GO:0035861 site of double-strand break
GO:0072686 mitotic spindle
GO:1904115 axon cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1f95, PDBe:1f95, PDBj:1f95
PDBsum1f95
PubMed11178896
UniProtP63170|DYL1_RAT Dynein light chain 1, cytoplasmic (Gene Name=Dynll1)

[Back to BioLiP]