Structure of PDB 1f5t Chain B

Receptor sequence
>1f5tB (length=120) Species: 1717 (Corynebacterium diphtheriae) [Search protein sequence]
KDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERD
GLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEA
DRWEHVMSDEVERRLVKVLK
3D structure
PDB1f5t Methyl groups of thymine bases are important for nucleic acid recognition by DtxR.
ChainB
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B T2007 Q2036 S2037 P2039 T2040 Q2043 R2047 R2050 T6 Q35 S36 P38 T39 Q42 R46 R49 PDBbind-CN: Kd=460nM
BS02 dna B K2002 R2027 A2028 R2029 S2042 R2060 K1 R26 A27 R28 S41 R59 PDBbind-CN: Kd=460nM
BS03 NI B M2010 D2102 E2105 H2106 M9 D101 E104 H105
BS04 NI B H2079 E2083 H2098 H78 E82 H97
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0046914 transition metal ion binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1f5t, PDBe:1f5t, PDBj:1f5t
PDBsum1f5t
PubMed10956029
UniProtP0DJL7|DTXR_CORDI Diphtheria toxin repressor (Gene Name=dtxR)

[Back to BioLiP]