Structure of PDB 1f4t Chain B

Receptor sequence

>1f4tB (length=367) Species: 2287 (Saccharolobus solfataricus)

MYDWFSEMRKKDPVYYDGNIWQVFSYRYTKEVLNNFSKFSSDLTGYHERL
EDLRNGKIRFDIPTRYTMLTSDPPLHDELRSMSADIFSPQKLQTLETFIR
ETTRSLLDSIDPREDDIVKKLAVPLPIIVISKILGLPIEDKEKFKEWSDL
VAFRLGKPGEIFELGKKYLELIGYVKDHLNSGTEVVSRVVNSNLSDIEKL
GYIILLLIAGNETTTNLISNSVIDFTRFNLWQRIREENLYLKAIEEALRY
SPPVMRTVRKTKERVKLGDQTIEEGEYVRVWIASANRDEEVFHDGEKFIP
DRNPNPHLSFGSGIHLCLGAPLARLEARIAIEEFSKRFRHIEILDTEKVP
NEVLNGYKRLVVRLKSN

3D structure

• PDB: 1f4t Crystal structure of a thermophilic cytochrome P450 from the archaeon Sulfolobus solfataricus.
• Chain: B
• Resolution: 1.93 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): F153 A209 E212 T213 T214 C317 L318 G319 E326 L354
• Catalytic site (residue number reindexed from 1): F153 A209 E212 T213 T214 C317 L318 G319 E326 L354
• Enzyme Commision number: 1.11.1.7: peroxidase.
  1.14.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	B	E139 H178	E139 H178
BS02	HEM	B	M68 L69 H76 R80 L205 G210 T213 T214 L217 T257 R259 S309 F310 G311 H315 C317 G319	M68 L69 H76 R80 L205 G210 T213 T214 L217 T257 R259 S309 F310 G311 H315 C317 G319
BS03	PIM	B	L155 G156 A209	L155 G156 A209

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0004601 peroxidase activity
• GO:0005506 iron ion binding
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0140825 lactoperoxidase activity

Biological Process

• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1f4t, PDBe:1f4t, PDBj:1f4t
• PDBsum: 1f4t
• PubMed: 10859321
• UniProt: Q55080|CP119_SULAC Cytochrome P450 119 (Gene Name=cyp119)