Structure of PDB 1eyg Chain B

Receptor sequence

>1eygB (length=104) Species: 562 (Escherichia coli)

ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWEQTEWHRVVL
FGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTM
QMLG

3D structure

• PDB: 1eyg Structure of the DNA binding domain of E. coli SSB bound to ssDNA.
• Chain: B
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	T2108 Q2110	T99 Q101
BS02	dna	B	A2001 N2013 G2015 T2033 A2035 S2037 E2050 T2052 W2054 H2055 R2056 F2060 K2073 G2074 R2084 R2086 W2088 Y2097 T2098 T2099 E2100 V2102 N2104 V2105 G2106	A1 N13 G15 T33 A35 S37 E41 T43 W45 H46 R47 F51 K64 G65 R75 R77 W79 Y88 T89 T90 E91 V93 N95 V96 G97

Gene Ontology

Molecular Function

• GO:0003697 single-stranded DNA binding

Biological Process

• GO:0006260 DNA replication

External links

• PDB: RCSB:1eyg, PDBe:1eyg, PDBj:1eyg
• PDBsum: 1eyg
• PubMed: 10932248
• UniProt: P0AGE0|SSB_ECOLI Single-stranded DNA-binding protein (Gene Name=ssb)