Structure of PDB 1eua Chain B

Receptor sequence

>1euaB (length=213) Species: 562 (Escherichia coli)

MKNWKTSAESILTTGPVVPVIVVKKLEHAVPMAKALVAGGVRVLEVTLRT
ECAVDAIRAIAKEVPEAIVGAGTVLNPQQLAEVTEAGAQFAISPGLTEPL
LKAATEGTIPLIPGISTVSELMLGMDYGLKEFKFFPAEANGGVKALQAIA
GPFSQVRFCPTGGISPANYRDYLALKSVLCIGGSWLVPADALEAGDYDRI
TKLAREAVEGAKL

3D structure

• PDB: 1eua Covalent intermediate trapped in 2-keto-3-deoxy-6- phosphogluconate (KDPG) aldolase structure at 1.95-A resolution.
• Chain: B
• Resolution: 1.95 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E45 R49 K133
• Catalytic site (residue number reindexed from 1): E45 R49 K133
• Enzyme Commision number: 4.1.2.14: 2-dehydro-3-deoxy-phosphogluconate aldolase.
  4.1.3.16: 4-hydroxy-2-oxoglutarate aldolase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PYR	B	E45 R49 T73 S93 P94 K133 F135	E45 R49 T73 S93 P94 K133 F135

Gene Ontology

Molecular Function

• GO:0008675 2-dehydro-3-deoxy-phosphogluconate aldolase activity
• GO:0008700 (R,S)-4-hydroxy-2-oxoglutarate aldolase activity
• GO:0008948 oxaloacetate decarboxylase activity
• GO:0016829 lyase activity
• GO:0016833 oxo-acid-lyase activity
• GO:0042802 identical protein binding
• GO:0106009 (4S)-4-hydroxy-2-oxoglutarate aldolase activity

Biological Process

• GO:0009255 Entner-Doudoroff pathway through 6-phosphogluconate

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0016020 membrane

External links

• PDB: RCSB:1eua, PDBe:1eua, PDBj:1eua
• PDBsum: 1eua
• PubMed: 11274385
• UniProt: P0A955|ALKH_ECOLI KHG/KDPG aldolase (Gene Name=eda)