Structure of PDB 1e5a Chain B

Receptor sequence

>1e5aB (length=116) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTNP

3D structure

• PDB: 1e5a Structure of Human Transthyretin Complexed with Bromophenols : A New Mode of Binding
• Chain: B
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TBP	B	K15 A108	K6 A99	MOAD: Kd=23nM PDBbind-CN: -logKd/Ki=7.64,Kd=23nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1e5a, PDBe:1e5a, PDBj:1e5a
• PDBsum: 1e5a
• PubMed: 10957627
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)