Structure of PDB 1e4h Chain B

Receptor sequence

>1e4hB (length=116) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTNP

3D structure

• PDB: 1e4h Structure of Human Transthyretin Complexed with Bromophenols : A New Mode of Binding
• Chain: B
• Resolution: 1.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PBR	B	K15 L17 A108 T119	K6 L8 A99 T110	MOAD: Kd=3.9nM PDBbind-CN: -logKd/Ki=8.41,Kd=3.9nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1e4h, PDBe:1e4h, PDBj:1e4h
• PDBsum: 1e4h
• PubMed: 10957627
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)