Structure of PDB 1e3i Chain B

Receptor sequence
>1e3iB (length=373) Species: 10090 (Mus musculus) [Search protein sequence]
GKVIKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINAT
DPKKKALFPVVLGHECAGIVESVGPGVTNFKPGDKVIPFFAPQCKRCKLC
LSPLTNLCGKLRNFKYPTIDQELMEDRTSRFTCKGRSIYHFMGVSSFSQY
TVVSEANLARVDDEANLERVCLIGCGFSSGYGAAINTAKVTPGSTCAVFG
LGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCLNPRELDKP
VQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAKVDEM
TIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVTHALP
FESINDAIDLMKEGKSIRTILTF
3D structure
PDB1e3i Crystal Structure of Mouse Class II Alcohol Dehydrogenase Reveal Determinants of Substrate Specificity and Catalytic Efficiency
ChainB
Resolution2.08 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) C46 P47 T48 N51 H67 E68 C97 C100 C103 C111 R115 C178 S182 R371
Catalytic site (residue number reindexed from 1) C43 P44 T45 N48 H64 E65 C94 C97 C100 C108 R112 C175 S179 R368
Enzyme Commision number 1.1.1.105: all-trans-retinol dehydrogenase (NAD(+)).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAI B P47 S182 G203 G205 V207 D227 I228 T278 V296 G297 T319 F320 P44 S179 G200 G202 V204 D224 I225 T275 V293 G294 T316 F317
BS02 CXF B C46 T48 F93 C178 C43 T45 F90 C175
BS03 ZN B C46 H67 C178 C43 H64 C175
BS04 ZN B C97 C103 C111 C94 C100 C108
Gene Ontology
Molecular Function
GO:0003960 NADPH:quinone reductase activity
GO:0004022 alcohol dehydrogenase (NAD+) activity
GO:0004032 aldose reductase (NADPH) activity
GO:0004745 all-trans-retinol dehydrogenase (NAD+) activity
GO:0005503 all-trans retinal binding
GO:0008270 zinc ion binding
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0018479 benzaldehyde dehydrogenase (NAD+) activity
GO:0019841 retinol binding
GO:0046872 metal ion binding
GO:0051287 NAD binding
Biological Process
GO:0001523 retinoid metabolic process
GO:0006066 alcohol metabolic process
GO:0006067 ethanol metabolic process
GO:0006081 cellular aldehyde metabolic process
GO:0006629 lipid metabolic process
GO:0010430 fatty acid omega-oxidation
GO:0042572 retinol metabolic process
GO:0044282 small molecule catabolic process
GO:0046164 alcohol catabolic process
GO:1901661 quinone metabolic process
Cellular Component
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1e3i, PDBe:1e3i, PDBj:1e3i
PDBsum1e3i
PubMed10970744
UniProtQ9QYY9|ADH4_MOUSE All-trans-retinol dehydrogenase [NAD(+)] ADH4 (Gene Name=Adh4)

[Back to BioLiP]