Structure of PDB 1e0e Chain B |
>1e0eB (length=46) Species: 11720 (Human immunodeficiency virus type 2 (ISOLATE ROD)) [Search protein sequence] |
FLEKIEPAQEEHEKYHSNVKELSHKFGIPNLVARQIVNSCAQCQQK |
|
PDB | 1e0e Refined Solution Structure of the Dimeric N-Terminal Hhcc Domain of HIV-2 Integrase |
Chain | B |
Resolution | N/A |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H12 H16 C40 C43 |
H12 H16 C40 C43 |
|
|
|
|