Structure of PDB 1e02 Chain B

Receptor sequence

>1e02B (length=147) Species: 9823 (Sus scrofa)

ELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSKEN
GICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGD
KTIMTGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDCPA

3D structure

• PDB: 1e02 Complexes of Porcine Odorant Binding Protein with Odorant Molecules Belonging to Different Chemical Classes
• Chain: B
• Resolution: 2.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UNA	B	F35 F55 F88 N102	F25 F45 F78 N92	MOAD: ic50=0.7uM

Gene Ontology

Molecular Function

• GO:0005549 odorant binding
• GO:0036094 small molecule binding

Biological Process

• GO:0007608 sensory perception of smell

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:1e02, PDBe:1e02, PDBj:1e02
• PDBsum: 1e02
• PubMed: 10864504
• UniProt: P81245|OBP_PIG Odorant-binding protein