Structure of PDB 1dzm Chain B

Receptor sequence

>1dzmB (length=147) Species: 9823 (Sus scrofa)

ELSGKWITSYIGSSDLEKIGENAPFQVFMRSIEFDDKESKVYLNFFSKEN
GICEEFSLIGTKQEGNTYDVNYAGNNKFVVSYASETALIISNINVDEEGD
KTIMTGLLGKGTDIEDQDLEKFKEVTRENGIPEENIVNIIERDDCPA

3D structure

• PDB: 1dzm Complexes of Porcine Odorant Binding Protein with Odorant Molecules Belonging to Different Chemical Classes
• Chain: B
• Resolution: 1.93 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BZM	B	I21 V80 N86 N102 M114 T115 G116	I11 V70 N76 N92 M104 T105 G106	MOAD: ic50=3.9uM

Gene Ontology

Molecular Function

• GO:0005549 odorant binding
• GO:0036094 small molecule binding

Biological Process

• GO:0007608 sensory perception of smell

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space

External links

• PDB: RCSB:1dzm, PDBe:1dzm, PDBj:1dzm
• PDBsum: 1dzm
• PubMed: 10864504
• UniProt: P81245|OBP_PIG Odorant-binding protein