Structure of PDB 1du0 Chain B

Receptor sequence
>1du0B (length=56) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFANK
RAKIKK
3D structure
PDB1du0 Exploring the role of glutamine 50 in the homeodomain-DNA interface: crystal structure of engrailed (Gln50 --> ala) complex at 2.0 A.
ChainB
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B Y125 E128 R131 R153 K157 Y23 E26 R29 R51 K55 PDBbind-CN: Kd=79pM
BS02 dna B R103 I147 N151 R1 I45 N49 PDBbind-CN: Kd=79pM
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1du0, PDBe:1du0, PDBj:1du0
PDBsum1du0
PubMed10889025
UniProtP02836|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]