Structure of PDB 1dsz Chain B

Receptor sequence
>1dszB (length=84) Species: 9606 (Homo sapiens) [Search protein sequence]
GSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDC
LIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQR
3D structure
PDB1dsz Structure of the RXR-RAR DNA-binding complex on the retinoic acid response element DR1.
ChainB
Resolution1.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B K1245 H1246 Y1247 R1264 Q1306 E1308 R1309 K18 H19 Y20 R37 Q79 E81 R82
BS02 dna B E1253 G1254 R1261 R1284 N1285 R1291 E26 G27 R34 R57 N58 R64
BS03 ZN B C1235 C1238 C1252 C1255 C8 C11 C25 C28
BS04 ZN B C1271 C1277 C1287 C1290 C44 C50 C60 C63
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1dsz, PDBe:1dsz, PDBj:1dsz
PDBsum1dsz
PubMed10698945
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]