Structure of PDB 1dc1 Chain B

Receptor sequence

>1dc1B (length=311) Species: 1422 (Geobacillus stearothermophilus)

QKPFENHLKSVDDLKTTYEEYRAGFIAFALEKNKRSTPYIERARALKVAA
SVAKTPKDLLYLEDIQDALLYASGISDKAKKFLTEDDKKESINNLIENFL
EPAGEEFIDELIFRYLLFQGDSLGGTMRNIAGALAQQKLTRAIISALDIA
NIPYKWLDSRDKKYTNWMDKPEDDYELETFAKGISWTINGKHRTLMYNIT
VSLVKKNVDICLFNCEPQQPEKYLLLGELKGGIDPAGADEHWKTANTALT
RIRNKFSEKGLSPKTIFIGAAIEHSMAEEIWDQLQSGSLTNSANLTKTEQ
VGSLCRWIINI

3D structure

• PDB: 1dc1 Restriction enzyme BsoBI-DNA complex: a tunnel for recognition of degenerate DNA sequences and potential histidine catalysis.
• Chain: B
• Resolution: 1.7 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	F31 R131 N132 G135 K209 N210 D212 K242 G243 G244 I245 D246 H253	F28 R128 N129 G132 K206 N207 D209 K230 G231 G232 I233 D234 H241
BS02	dna	B	Y74 S79 D80 K81 D124 S125 G128 R131 N132 K165 Y167 A248 E252 K255 S287	Y71 S76 D77 K78 D121 S122 G125 R128 N129 K162 Y164 A236 E240 K243 S275

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity
• GO:0009036 type II site-specific deoxyribonuclease activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009307 DNA restriction-modification system

External links

• PDB: RCSB:1dc1, PDBe:1dc1, PDBj:1dc1
• PDBsum: 1dc1
• PubMed: 11250198
• UniProt: P70985|T2B1_GEOSE Type II restriction enzyme BsoBI (Gene Name=bsoBIR)