Structure of PDB 1d8t Chain B

Receptor sequence

>1d8tB (length=385) Species: 562 (Escherichia coli)

KPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKAR
GITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAAT
DGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLS
QYDFPGDDTPIVRGSALKALEGDAEWEAKILELAGFLDSYIPEPERAIDK
PFLLPIEDVFSISGRGTVVTGRVERGIIKVGEEVEIVGIKETQKSTCTGV
EMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIKPHTKFESEV
YILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKM
VVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG

3D structure

• PDB: 1d8t Structure of an EF-TU Complex with a Thiazolyl Peptide Antibiotic Determined at 2.35 A Resolution: Atomic Basis for Ge2270A Inhibition of EF-TU.
• Chain: B
• Resolution: 2.35 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D21 K24 T25 T61 H84
• Catalytic site (residue number reindexed from 1): D13 K16 T17 T53 H76

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	E215 D216 F218 R223 V226 T228 G229 T256 G257 E259 F261 R262 L264 N273 V274 G275 L277	E207 D208 F210 R215 V218 T220 G221 T248 G249 E251 F253 R254 L256 N265 V266 G267 L269
BS02	GDP	B	D21 G23 K24 T25 T26 F46 N135 K136 D138 M139 S173 L175	D13 G15 K16 T17 T18 F38 N127 K128 D130 M131 S165 L167

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003746 translation elongation factor activity
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0097216 guanosine tetraphosphate binding

Biological Process

• GO:0006412 translation
• GO:0006414 translational elongation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0032045 guanyl-nucleotide exchange factor complex

External links

• PDB: RCSB:1d8t, PDBe:1d8t, PDBj:1d8t
• PDBsum: 1d8t
• PubMed: 10625477
• UniProt: P0CE47|EFTU1_ECOLI Elongation factor Tu 1 (Gene Name=tufA)