Structure of PDB 1d7x Chain B

Receptor sequence
>1d7xB (length=173) Species: 9606 (Homo sapiens) [Search protein sequence]
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTF
SRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDD
DEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRF
RLSQDDINGIQSLYGPPPDSPET
3D structure
PDB1d7x Design, synthesis, and biological evaluation of matrix metalloproteinase inhibitors derived from a modified proline scaffold.
ChainB
Resolution2.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H701 E702 H705 H711
Catalytic site (residue number reindexed from 1) H119 E120 H123 H129
Enzyme Commision number 3.4.24.17: stromelysin 1.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN B H701 H705 H711 H119 H123 H129
BS02 ZN B H651 D653 H666 H679 H69 D71 H84 H97
BS03 CA B D658 G659 G661 V663 D681 E684 D76 G77 G79 V81 D99 E102
BS04 CA B D607 D682 E684 D25 D100 E102
BS05 CA B D641 G673 N675 D677 D59 G91 N93 D95
BS06 SPC B V663 L664 A665 H701 E702 H705 H711 L722 Y723 V81 L82 A83 H119 E120 H123 H129 L140 Y141 PDBbind-CN: -logKd/Ki=8.52,IC50=3nM
BindingDB: IC50=19nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1d7x, PDBe:1d7x, PDBj:1d7x
PDBsum1d7x
PubMed10639284
UniProtP08254|MMP3_HUMAN Stromelysin-1 (Gene Name=MMP3)

[Back to BioLiP]