Structure of PDB 1cz0 Chain B

Receptor sequence
>1cz0B (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
3D structure
PDB1cz0 A novel endonuclease mechanism directly visualized for I-PpoI.
ChainB
Resolution2.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R261 H298 C305 N319
Catalytic site (residue number reindexed from 1) R60 H97 C104 N118
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B N257 R261 Q263 R274 G276 T295 A296 H298 N319 N323 N56 R60 Q62 R73 G75 T94 A95 H97 N118 N122
BS02 dna B A248 P249 V252 G253 K256 N257 T267 A47 P48 V51 G52 K55 N56 T66
BS03 ZN B C325 C332 H334 C338 C124 C131 H133 C137
BS04 ZN B C241 C300 C305 H310 C40 C99 C104 H109
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1cz0, PDBe:1cz0, PDBj:1cz0
PDBsum1cz0
PubMed10581547
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]