Structure of PDB 1cxv Chain B

Receptor sequence

>1cxvB (length=160) Species: 10090 (Mus musculus) [Search protein sequence]

YNVFPRTLKWSQTNLTYRIVNYTPDMSHSEVEKAFRKAFKVWSDVTPLNF
TRIYDGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDD
DETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGALMFPIYTYTFMLPDD
DVQGIQFLYG

3D structure

PDB

1cxv Structure of recombinant mouse collagenase-3 (MMP-13).

Chain

Resolution

2.0 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H501 E502 H505 H511
Catalytic site (residue number reindexed from 1)	H119 E120 H123 H129
Enzyme Commision number	3.4.24.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ZN	B	H501 H505 H511	H119 H123 H129
BS02	ZN	B	H451 D453 H466 H479	H69 D71 H84 H97
BS03	CA	B	D441 N473 G475 D477	D59 N91 G93 D95
BS04	CA	B	D458 G459 S461 L463 D481 E484	D76 G77 S79 L81 D99 E102
BS05	CBP	B	L463 L464 A465 I497 H501 E502 H505 H511 L518 F520 I522 Y523 T524	L81 L82 A83 I115 H119 E120 H123 H129 L136 F138 I140 Y141 T142

Gene Ontology

	Molecular Function
GO:0004222	metalloendopeptidase activity
GO:0008237	metallopeptidase activity
GO:0008270	zinc ion binding

	Biological Process
GO:0006508	proteolysis

	Cellular Component
GO:0031012	extracellular matrix

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1cxv, PDBe:1cxv, PDBj:1cxv
PDBsum	1cxv
PubMed	10525409
UniProt	P33435\|MMP13_MOUSE Collagenase 3 (Gene Name=Mmp13)

[Back to BioLiP]