Structure of PDB 1cqt Chain B

Receptor sequence

>1cqtB (length=129) Species: 9606 (Homo sapiens)

DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYNDFSQTTISRFEALNL
SFKNMCKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKTSEEIT
MIADQLNMEKEVIRVWFCNRRQKEKRINP

3D structure

• PDB: 1cqt Crystal structure of an OCA-B peptide bound to an Oct-1 POU domain/octamer DNA complex: specific recognition of a protein-DNA interface.
• Chain: B
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	T526 Q527 Q544 S548 R602 K603 K604 R605 T606 V644 V647 W648 N651 R652 K655	T22 Q23 Q39 S43 R71 K72 K73 R74 T75 V112 V115 W116 N119 R120 K123
BS02	dna	B	D541 F542 S543 T545 T546 R549 S556 N559 K562 R602 R605 S607 Q654 K657	D36 F37 S38 T40 T41 R44 S51 N54 K57 R71 R74 S76 Q122 K125
BS03	peptide	B	E510 L553 N554 L555 S556 M560 K655 R658 I659	E6 L48 N49 L50 S51 M55 K123 R126 I127

Gene Ontology

Molecular Function

• GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:1cqt, PDBe:1cqt, PDBj:1cqt
• PDBsum: 1cqt
• PubMed: 10541551
• UniProt: P14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)