Structure of PDB 1cqf Chain B

Receptor sequence
>1cqfB (length=69) Species: 562 (Escherichia coli) [Search protein sequence]
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTV
TIKTNACHNGGTFSEVIFR
3D structure
PDB1cqf The Complex of the Mutated Shiga Toxin B Subunit and Gb3 Trisaccharide
ChainB
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GLA B D218 W234 D18 W34
BS02 GLA B R233 W234 N235 R33 W34 N35
BS03 GAL B D217 F230 G260 D17 F30 G60
BS04 GLA B N215 T221 E228 G260 N15 T21 E28 G60
Gene Ontology
Biological Process
GO:0019836 hemolysis by symbiont of host erythrocytes
GO:0098676 modulation of host virulence by virus
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1cqf, PDBe:1cqf, PDBj:1cqf
PDBsum1cqf
PubMed
UniProtP69179|STXB_BPH19 Shiga-like toxin 1 subunit B (Gene Name=stxB)

[Back to BioLiP]