Structure of PDB 1c9o Chain B |
>1c9oB (length=66) Species: 1394 ([Bacillus] caldolyticus) [Search protein sequence] |
MQRGKVKWFNNEKGYGFIEVEGGSDVFVHFTAIQGEGFKTLEEGQEVSFE IVQGNRGPQAANVVKL |
|
PDB | 1c9o Thermal stability and atomic-resolution crystal structure of the Bacillus caldolyticus cold shock protein. |
Chain | B |
Resolution | 1.17 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
NA |
B |
V20 G23 |
V20 G23 |
|
|
|
|