Structure of PDB 1c6y Chain B

Receptor sequence
>1c6yB (length=99) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence]
PQITLWQRPVVTIKIGGQLMEALIDTGADDTVLEEMDLPGRWKPKIIGGI
GGFVKVRQYDQIPIEICGHKVIGTVLVGPTPTNIIGRNLLTQIGCTLNF
3D structure
PDB1c6y An alternate binding site for the P1-P3 group of a class of potent HIV-1 protease inhibitors as a result of concerted structural change in the 80s loop of the protease.
ChainB
Resolution2.5 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) D225 T226 G227
Catalytic site (residue number reindexed from 1) D25 T26 G27
Enzyme Commision number 3.4.24.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MK1 B D225 G227 A228 D229 D230 V232 G248 P281 I284 D25 G27 A28 D29 D30 V32 G48 P81 I84 MOAD: Ki=0.31nM
PDBbind-CN: -logKd/Ki=9.51,Ki=0.31nM
Gene Ontology
Molecular Function
GO:0004190 aspartic-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1c6y, PDBe:1c6y, PDBj:1c6y
PDBsum1c6y
PubMed10739910
UniProtO09893

[Back to BioLiP]