Structure of PDB 1c6o Chain B

Receptor sequence

>1c6oB (length=89) Species: 3088 (Tetradesmus obliquus)

SADLALGKQTFEANCAACHAGGNNSVIPDHTLRKAAMEQFLQGGFNLEAI
TYQVENGKGAMPAWSGTLDDDEIAAVAAYVYDQASGDKW

3D structure

• PDB: 1c6o Amino acid sequence, crystallization and structure determination of reduced and oxidized cytochrome c6 from the green alga Scenedesmus obliquus.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	B	C15 C18 H19 N24 V26 H30 T31 L32 A36 M37 Q53 K58 M61 W64	C15 C18 H19 N24 V26 H30 T31 L32 A36 M37 Q53 K58 M61 W64

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009543 chloroplast thylakoid lumen
• GO:0009579 thylakoid

External links

• PDB: RCSB:1c6o, PDBe:1c6o, PDBj:1c6o
• PDBsum: 1c6o
• PubMed: 10438600
• UniProt: P57736|CYC6_TETOB Cytochrome c6 (Gene Name=petJ)