Structure of PDB 1c3v Chain B

Receptor sequence
>1c3vB (length=245) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
MRVGVLGAKGKVGTTMVRAVAAADDLTLSAELDAGDPLSLLTDGNTEVVI
DFTHPDVVMGNLEFLIDNGIHAVVGTTGFTAERFQQVESWLVAKPNTSVL
IAPNFAIGAVLSMHFAKQAARFFDSAEVIELHHPHKADAPSGTAARTAKL
IAEARKGLPPNPDATSTSLPGARGADVDGIPVHAVRLAGLVAHQEVLFGT
EGETLTIRHDSLDRTSFVPGVLLAVRRIAERPGLTVGLEPLLDLH
3D structure
PDB1c3v The three-dimensional structures of the Mycobacterium tuberculosis dihydrodipicolinate reductase-NADH-2,6-PDC and -NADPH-2,6-PDC complexes. Structural and mutagenic analysis of relaxed nucleotide specificity
ChainB
Resolution2.39 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H1132 K1136
Catalytic site (residue number reindexed from 1) H132 K136
Enzyme Commision number 1.17.1.8: 4-hydroxy-tetrahydrodipicolinate reductase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NDP B K1009 G1010 K1011 V1012 D1033 A1034 F1052 T1053 V1057 G1075 T1076 T1077 P1103 N1104 F1105 K9 G10 K11 V12 D33 A34 F52 T53 V57 G75 T76 T77 P103 N104 F105 MOAD: Kd=2.1uM
BS02 PDC B T1077 N1104 K1136 S1141 G1142 T1143 A1192 T77 N104 K136 S141 G142 T143 A192
Gene Ontology
Molecular Function
GO:0008839 4-hydroxy-tetrahydrodipicolinate reductase
GO:0016491 oxidoreductase activity
GO:0016726 oxidoreductase activity, acting on CH or CH2 groups, NAD or NADP as acceptor
GO:0050661 NADP binding
GO:0051287 NAD binding
GO:0070402 NADPH binding
GO:0070404 NADH binding
Biological Process
GO:0009085 lysine biosynthetic process
GO:0009089 lysine biosynthetic process via diaminopimelate
GO:0019877 diaminopimelate biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009274 peptidoglycan-based cell wall

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1c3v, PDBe:1c3v, PDBj:1c3v
PDBsum1c3v
PubMed12962488
UniProtP9WP23|DAPB_MYCTU 4-hydroxy-tetrahydrodipicolinate reductase (Gene Name=dapB)

[Back to BioLiP]