Structure of PDB 1c09 Chain B |
>1c09B (length=53) Species: 1501 (Clostridium pasteurianum) [Search protein sequence] |
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCGAGKDQFE EVE |
|
PDB | 1c09 Modulation of the redox potential of the [Fe(SCys)(4)] site in rubredoxin by the orientation of a peptide dipole. |
Chain | B |
Resolution | 1.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
B |
C6 C9 C39 C42 |
C6 C9 C39 C42 |
|
|
|
|