Structure of PDB 1byo Chain B |
>1byoB (length=99) Species: 52853 (Silene latifolia subsp. alba) [Search protein sequence] |
AEVLLGSSDGGLAFVPSDLSIASGEKITFKNNAGFPHNDLFDEDEVPAGV DVTKISMPEEDLLNAPGEEYSVTLTEKGTYKFYCAPHAGAGMVGKVTVN |
|
PDB | 1byo Crystal structures of wild-type and mutant plastocyanins from a higher plant, Silene. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
B |
H37 C84 H87 |
H37 C84 H87 |
|
|
|
|