Structure of PDB 1byf Chain B |
>1byfB (length=123) Species: 7723 (Polyandrocarpa misakiensis) [Search protein sequence] |
DYEILFSDETMNYADAGTYCQSRGMALVSSAMRDSTMVKAILAFTEVKGH DYWVGADNLQDGAYNFLWNDGVSLPTDSDLWSPNEPSNPQSWQLCVQIWS KYNLLDDVGCGGARRVICEKELD |
|
PDB | 1byf The structure of a tunicate C-type lectin from Polyandrocarpa misakiensis complexed with D -galactose. |
Chain | B |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
B |
E86 N89 D107 D108 |
E85 N88 D106 D107 |
|
|
|
|