Structure of PDB 1by4 Chain B

Receptor sequence
>1by4B (length=82) Species: 9606 (Homo sapiens) [Search protein sequence]
GSFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDC
LIDKRQRNRCQYCRYQKCLAMGMKREAVQEER
3D structure
PDB1by4 Structural basis of RXR-DNA interactions.
ChainB
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B K1245 H1246 R1264 Q1306 R1309 K18 H19 R37 Q79 R82 PDBbind-CN: Kd=350nM
BS02 dna B E1253 G1254 R1261 R1284 N1285 R1291 E26 G27 R34 R57 N58 R64 PDBbind-CN: Kd=350nM
BS03 dna B N1285 R1286 N58 R59 PDBbind-CN: Kd=350nM
BS04 ZN B C1235 C1252 C1255 C8 C25 C28
BS05 ZN B C1271 C1277 C1287 C1290 C44 C50 C60 C63
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1by4, PDBe:1by4, PDBj:1by4
PDBsum1by4
PubMed10669605
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]