Structure of PDB 1bxg Chain B

Receptor sequence

>1bxgB (length=347) Species: 1831 (Rhodococcus sp. (in: high G+C Gram-positive bacteria))

SIDSALNWDGEMTVTRFDRMTGAHFVIRLDSTQLGPAAGGTRAAQYSQLA
DALTDAGKLAGAMTLKMAVSNLPMGGGKSVIALPAPRHSIDPSTWARILR
IHAENIDKLSGNYWTGPDVNTNSADMDTLNDTTEFVFGRSLERGGAGSSA
FTTAVGVFEAMKATVAHRGLGSLDGLTVLVQGLGAVGGSLASLAAEAGAQ
LLVADTDTERVAHAVALGHTAVALEDVLSTPCDVFAPCAMGGVITTEVAR
TLDCSVVAGAANNVIADEAASDILHARGILYAPDFVANAGGAIHLVGREV
LGWSESVVHERAVAIGDTLNQVFEISDNDGVTPDEAARTLAGRRARE

3D structure

• PDB: 1bxg Phenylalanine dehydrogenase from Rhodococcus sp. M4: high-resolution X-ray analyses of inhibitory ternary complexes reveal key features in the oxidative deamination mechanism.
• Chain: B
• Resolution: 2.3 Å

Enzymatic activity

• Enzyme Commision number: 1.4.1.20: phenylalanine dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	B	T553 G582 L583 G584 A585 V586 A604 D605 T606 R610 L624 C638 A639 A660 A661 N662 N688	T153 G182 L183 G184 A185 V186 A204 D205 T206 R210 L224 C238 A239 A260 A261 N262 N288
BS02	HCI	B	G439 G440 K466 G516 N662	G39 G40 K66 G116 N262

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0016491 oxidoreductase activity
• GO:0016639 oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
• GO:0050175 phenylalanine dehydrogenase activity

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0006559 L-phenylalanine catabolic process
• GO:0009094 L-phenylalanine biosynthetic process

External links

• PDB: RCSB:1bxg, PDBe:1bxg, PDBj:1bxg
• PDBsum: 1bxg
• PubMed: 10029526
• UniProt: Q59771|DHPH_RHOSO Phenylalanine dehydrogenase (Gene Name=pdh)