Structure of PDB 1brr Chain B

Receptor sequence

>1brrB (length=231) Species: 2242 (Halobacterium salinarum)

AQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPA
IAFTMYLSMLLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLV
DADQGTILALVGADGIMIGTGLVGALTKVYSYRFVWWAISTAAMLYILYV
LFFGFTSKAESMRPEVASTFKVLRNVTVVLWSAYPVVWLIGSEGAGIVPL
NIETLLFMVLDVSAKVGFGLILLRSRAIFGE

3D structure

• PDB: 1brr Lipid patches in membrane protein oligomers: crystal structure of the bacteriorhodopsin-lipid complex
• Chain: B
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLC	B	T67 L127	T66 L126
BS02	RET	B	W86 T90 M118 W138 S141 T142 W182 Y185 P186 K216	W85 T89 M117 W137 S140 T141 W181 Y184 P185 K215
BS03	ARC	B	G106 T107 A110 A143 A144 Y147	G105 T106 A109 A142 A143 Y146
BS04	ARC	B	M56 W80 F88	M55 W79 F87
BS05	ARC	B	F88 L123	F87 L122
BS06	ARC	B	G116 G120	G115 G119
BS07	ARC	B	L28 K40 T47	L27 K39 T46

Gene Ontology

Molecular Function

• GO:0005216 monoatomic ion channel activity
• GO:0009881 photoreceptor activity
• GO:0015454 light-driven active monoatomic ion transmembrane transporter activity

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007602 phototransduction
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:1brr, PDBe:1brr, PDBj:1brr
• PDBsum: 1brr
• PubMed: 9751724
• UniProt: P02945|BACR_HALSA Bacteriorhodopsin (Gene Name=bop)