Structure of PDB 1bm7 Chain B

Receptor sequence

>1bm7B (length=114) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVT

3D structure

• PDB: 1bm7 Inhibiting transthyretin conformational changes that lead to amyloid fibril formation.
• Chain: B
• Resolution: 2.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FLF	B	K15 A108 S117 T119	K6 A99 S108 T110	MOAD: Kd=30nM PDBbind-CN: -logKd/Ki=7.52,Kd=30nM BindingDB: IC50=2900nM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1bm7, PDBe:1bm7, PDBj:1bm7
• PDBsum: 1bm7
• PubMed: 9789022
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)