Structure of PDB 1biu Chain B |
>1biuB (length=146) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
CSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLA GRWPVKTVHTDNGSNFTSTTVKAACEWGGIKQEFGGVIESMNKELKKIIG QVRDQAEHLKTAVQMAVFIHNKKRKGGIGGYSAGERIVDIIATDIQ |
|
PDB | 1biu Three new structures of the core domain of HIV-1 integrase: an active site that binds magnesium. |
Chain | B |
Resolution | 2.5 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
B |
D64 D116 |
D9 D61 |
|
|
|
|