Structure of PDB 1bi3 Chain B |
>1bi3B (length=137) Species: 1717 (Corynebacterium diphtheriae) [Search protein sequence] |
LVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGL VVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACR WEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGV |
|
PDB | 1bi3 Motion of the DNA-binding domain with respect to the core of the diphtheria toxin repressor (DtxR) revealed in the crystal structures of apo- and holo-DtxR. |
Chain | B |
Resolution | 2.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
B |
H79 E83 H98 |
H76 E80 H95 |
|
|
|
|