Structure of PDB 1bh9 Chain B

Receptor sequence
>1bh9B (length=89) Species: 9606 (Homo sapiens) [Search protein sequence]
FSEEQLNRYEMYRRSAFPKAAIKRLIQSITGTSVSQNVVIAMSGISKVFV
GEVVEEALDVCEKWGEMPPLQPKHMREAVRRLKSKGQIP
3D structure
PDB1bh9 Human TAF(II)28 and TAF(II)18 interact through a histone fold encoded by atypical evolutionary conserved motifs also found in the SPT3 family.
ChainB
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PMB B C173 E174 E178 M179 C61 E62 E66 M67
Gene Ontology
Molecular Function
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0051123 RNA polymerase II preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005669 transcription factor TFIID complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bh9, PDBe:1bh9, PDBj:1bh9
PDBsum1bh9
PubMed9695952
UniProtQ15544|TAF11_HUMAN Transcription initiation factor TFIID subunit 11 (Gene Name=TAF11)

[Back to BioLiP]