Structure of PDB 1b8d Chain B

Receptor sequence

>1b8dB (length=177) Species: 42003 (Griffithsia monilis)

MLDAFSRVVVTSDAKAAYVGGSDLQSLKSFINDGNKRLDAVNYIVSNASC
IVSDAVSGMICENPGLIAPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DSSVLDDRCLNGLKETYIALGVPTASSSRAVSIMKATATAFITNTASGRK
VEVAAGDCQALQAEAASYFDKVGSSID

3D structure

• PDB: 1b8d Crystal structure of a phycourobilin-containing phycoerythrin at 1.90-A resolution.
• Chain: B
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PEB	B	M59 N72 C73 R77 R78 A81 C82 R84 D85 I88 L120 V122 P123 S127	M59 N72 C73 R77 R78 A81 C82 R84 D85 I88 L120 V122 P123 S127
BS02	PEB	B	N35 K36 L38 D39 I142 V153 A154 G156 C158	N35 K36 L38 D39 I142 V153 A154 G156 C158
BS03	PUB	B	C50 D54 S57 G58 C61 R129 I133 A136 T137 S147 G148	C50 D54 S57 G58 C61 R129 I133 A136 T137 S147 G148

Gene Ontology

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0030089 phycobilisome

External links

• PDB: RCSB:1b8d, PDBe:1b8d, PDBj:1b8d
• PDBsum: 1b8d
• PubMed: 10388620
• UniProt: O36004|PHEB_GRIMO R-phycoerythrin beta chain (Gene Name=cpeB)