Structure of PDB 1b72 Chain B

Receptor sequence
>1b72B (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]
RKRRNFNKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWF
GNKRIRYKKNIGKFQEEANIYAA
3D structure
PDB1b72 Structure of a HoxB1-Pbx1 heterodimer bound to DNA: role of the hexapeptide and a fourth homeodomain helix in complex formation.
ChainB
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna B R237 Q279 N282 N286 R290 R3 Q45 N48 N52 R56
BS02 dna B R235 R237 N239 Y260 R288 I289 K292 R1 R3 N5 Y26 R54 I55 K58
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1b72, PDBe:1b72, PDBj:1b72
PDBsum1b72
PubMed10052460
UniProtP40424|PBX1_HUMAN Pre-B-cell leukemia transcription factor 1 (Gene Name=PBX1)

[Back to BioLiP]