Structure of PDB 1b3a Chain B

Receptor sequence
>1b3aB (length=67) Species: 9606 (Homo sapiens) [Search protein sequence]
PYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCA
NPEKKWVREYINSLEMS
3D structure
PDB1b3a Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV protein AOP-RANTES.
ChainB
Resolution1.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 AOP B C11 F12 A13 Y14 N36 C10 F11 A12 Y13 N35
Gene Ontology
Molecular Function
GO:0004435 phosphatidylinositol phospholipase C activity
GO:0004672 protein kinase activity
GO:0005125 cytokine activity
GO:0005515 protein binding
GO:0008009 chemokine activity
GO:0016004 phospholipase activator activity
GO:0030298 receptor signaling protein tyrosine kinase activator activity
GO:0031726 CCR1 chemokine receptor binding
GO:0031729 CCR4 chemokine receptor binding
GO:0031730 CCR5 chemokine receptor binding
GO:0042056 chemoattractant activity
GO:0042379 chemokine receptor binding
GO:0042802 identical protein binding
GO:0042803 protein homodimerization activity
GO:0046817 chemokine receptor antagonist activity
GO:0048020 CCR chemokine receptor binding
Biological Process
GO:0002407 dendritic cell chemotaxis
GO:0002548 monocyte chemotaxis
GO:0002676 regulation of chronic inflammatory response
GO:0006816 calcium ion transport
GO:0006874 intracellular calcium ion homeostasis
GO:0006887 exocytosis
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0007159 leukocyte cell-cell adhesion
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007267 cell-cell signaling
GO:0009615 response to virus
GO:0009636 response to toxic substance
GO:0010759 positive regulation of macrophage chemotaxis
GO:0010820 positive regulation of T cell chemotaxis
GO:0014911 positive regulation of smooth muscle cell migration
GO:0030335 positive regulation of cell migration
GO:0031328 positive regulation of cellular biosynthetic process
GO:0031584 activation of phospholipase D activity
GO:0033634 positive regulation of cell-cell adhesion mediated by integrin
GO:0034097 response to cytokine
GO:0034112 positive regulation of homotypic cell-cell adhesion
GO:0034612 response to tumor necrosis factor
GO:0035689 chemokine (C-C motif) ligand 5 signaling pathway
GO:0042102 positive regulation of T cell proliferation
GO:0042119 neutrophil activation
GO:0042327 positive regulation of phosphorylation
GO:0043922 negative regulation by host of viral transcription
GO:0044344 cellular response to fibroblast growth factor stimulus
GO:0045070 positive regulation of viral genome replication
GO:0045071 negative regulation of viral genome replication
GO:0045089 positive regulation of innate immune response
GO:0045744 negative regulation of G protein-coupled receptor signaling pathway
GO:0045745 positive regulation of G protein-coupled receptor signaling pathway
GO:0045785 positive regulation of cell adhesion
GO:0045948 positive regulation of translational initiation
GO:0048245 eosinophil chemotaxis
GO:0048246 macrophage chemotaxis
GO:0048661 positive regulation of smooth muscle cell proliferation
GO:0050673 epithelial cell proliferation
GO:0050679 positive regulation of epithelial cell proliferation
GO:0050796 regulation of insulin secretion
GO:0050863 regulation of T cell activation
GO:0050918 positive chemotaxis
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0051928 positive regulation of calcium ion transport
GO:0060326 cell chemotaxis
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0070098 chemokine-mediated signaling pathway
GO:0070100 negative regulation of chemokine-mediated signaling pathway
GO:0070233 negative regulation of T cell apoptotic process
GO:0070234 positive regulation of T cell apoptotic process
GO:0071346 cellular response to type II interferon
GO:0071347 cellular response to interleukin-1
GO:0071356 cellular response to tumor necrosis factor
GO:0090026 positive regulation of monocyte chemotaxis
GO:0097696 cell surface receptor signaling pathway via STAT
GO:0098586 cellular response to virus
GO:1904894 positive regulation of receptor signaling pathway via STAT
GO:2000110 negative regulation of macrophage apoptotic process
GO:2000406 positive regulation of T cell migration
GO:2000503 positive regulation of natural killer cell chemotaxis
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1b3a, PDBe:1b3a, PDBj:1b3a
PDBsum1b3a
PubMed9889151
UniProtP13501|CCL5_HUMAN C-C motif chemokine 5 (Gene Name=CCL5)

[Back to BioLiP]